PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G1503
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 367aa    MW: 40962.8 Da    PI: 7.7651
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G1503genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++Ggg+W+  +++ g+ R++k+c++rw +yl
      Gh_A12G1503 14 KGPWTPEEDQKLLSYIQEHGGGSWRGLPAKAGLQRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.74.2e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ +E+  +++++++lG++ W++Ia++++ +Rt++++k++w++
      Gh_A12G1503  67 RGKFSSQEERTIIQLHALLGNR-WSAIAAHLP-KRTDNEIKNYWNT 110
                      89********************.*********.***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.787961IPR017930Myb domain
SuperFamilySSF466899.36E-3011108IPR009057Homeodomain-like
SMARTSM007172.1E-121363IPR001005SANT/Myb domain
PfamPF002493.3E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-241568IPR009057Homeodomain-like
CDDcd001672.28E-101661No hitNo description
PROSITE profilePS5129425.27962116IPR017930Myb domain
SMARTSM007171.0E-1566114IPR001005SANT/Myb domain
PfamPF002492.2E-1567111IPR001005SANT/Myb domain
CDDcd001676.04E-1169110No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2569116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MQQSPCSDKV GLKKGPWTPE EDQKLLSYIQ EHGGGSWRGL PAKAGLQRCG KSCRLRWINY  60
LRPDIKRGKF SSQEERTIIQ LHALLGNRWS AIAAHLPKRT DNEIKNYWNT QLKKRLTTIG  120
IDPATHRPKT DTLGSTPKDA ANLSHMAQWE SARLEAEARL VRESKRVSNP PQNQFRFTSS  180
SAPPLVNKID VGLAHATKPQ CLDVLKAWQR VVTGLFTFNT DNLQSPTSTS SFTENTLPIS  240
SVGFIDSFVG NSNNSCCGNN WECVEKSSQV AELQEILDNS MGLHDILDLS SEDVWFQGSY  300
RAENMMEGYS DTLMVCDSGD HPKSLSMEPR QNFNVGTSNA SSFEENKNYW NNILNFANAS  360
PSGSSVF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-29121185110B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.21880.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM1340840.0HM134084.1 Gossypium hirsutum note D genome MYB25-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438544.10.0PREDICTED: transcription factor MYB122-like
TrEMBLF2W3Z20.0F2W3Z2_G
STRINGPOPTR_0010s17300.11e-138(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1930556
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-104myb domain protein 16
Publications ? help Back to Top
  1. Wu Y,Machado AC,White RG,Llewellyn DJ,Dennis ES
    Expression profiling identifies genes expressed early during lint fibre initiation in cotton.
    Plant Cell Physiol., 2006. 47(1): p. 107-27
    [PMID:16278222]
  2. Walford SA,Wu Y,Llewellyn DJ,Dennis ES
    GhMYB25-like: a key factor in early cotton fibre development.
    Plant J., 2011. 65(5): p. 785-97
    [PMID:21235650]